(data stored in ACNUC7421 zone)

EMBL: CP001069.PE543

CP001069.PE543       Location/Qualifiers
FT   CDS             626386..628221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4324"
FT                   /product="protein of unknown function DUF1302"
FT                   /note="PFAM: protein of unknown function DUF1302; KEGG:
FT                   reu:Reut_C6389 protein of unknown function DUF1302"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4324"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29419"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIL8"
FT                   /protein_id="ACD29419.1"
FT                   /translation="MNTKKMSTRTAISLAVLAATTSAAYAYDFTLGTDDAVKGSLVSNI
FT                   TAGVATRTKSPSCALTGDPNANGCGAAANTDQWGAGDNGDLNYRKWKPYSTYLSATSEL
FT                   LLTMPSEGLKFMARGTGMYDFMAKNTERTPLSSDARAQVVYDAHVLDLWAQKDFTVADQ
FT                   NAHVRIGNQVINWGESMYAMGGINATNSLDIQKLLIPGSQLKQALLPAPMVSFATNLSH
FT                   GLSTEAYYQFIWNGNRMPPVGSFWSASNAVGRGAEPFTVNTTNFNANGPSAGTVAGQNG
FT                   LNSHDPGTIAAINNGLVNGDFAGPPSFSIGLPVSNKLPSKYKPQFGVKFNYVPTSIDAN
FT                   FAFYYENYTDKSPVLSSFTNNTAQWSYQQNRQLFGISANFPVGPWAVGTELSYRPRDAV
FT                   ALSGCYGAGGPMDLNVNPAGVDCQQWVDRKKLQFGINGILALTRSEYPFLKMIGADSAS
FT                   LTAEATMVYYPGLGGSVTRTINGVQVMQAPQAGYLTWLNNNSGTGYPIGMRQGTAASGG
FT                   VTVDFNWTYDGTLIPGWQVTPGVTFNAGLYGYTPTFNANYMQGAKSANFYVLFNQNPTV
FT                   WQAGINFTAFWGGHNTVGNPYSDRNFIGAFVTRNF"
     MNTKKMSTRT AISLAVLAAT TSAAYAYDFT LGTDDAVKGS LVSNITAGVA TRTKSPSCAL        60
     TGDPNANGCG AAANTDQWGA GDNGDLNYRK WKPYSTYLSA TSELLLTMPS EGLKFMARGT       120
     GMYDFMAKNT ERTPLSSDAR AQVVYDAHVL DLWAQKDFTV ADQNAHVRIG NQVINWGESM       180
     YAMGGINATN SLDIQKLLIP GSQLKQALLP APMVSFATNL SHGLSTEAYY QFIWNGNRMP       240
     PVGSFWSASN AVGRGAEPFT VNTTNFNANG PSAGTVAGQN GLNSHDPGTI AAINNGLVNG       300
     DFAGPPSFSI GLPVSNKLPS KYKPQFGVKF NYVPTSIDAN FAFYYENYTD KSPVLSSFTN       360
     NTAQWSYQQN RQLFGISANF PVGPWAVGTE LSYRPRDAVA LSGCYGAGGP MDLNVNPAGV       420
     DCQQWVDRKK LQFGINGILA LTRSEYPFLK MIGADSASLT AEATMVYYPG LGGSVTRTIN       480
     GVQVMQAPQA GYLTWLNNNS GTGYPIGMRQ GTAASGGVTV DFNWTYDGTL IPGWQVTPGV       540
     TFNAGLYGYT PTFNANYMQG AKSANFYVLF NQNPTVWQAG INFTAFWGGH NTVGNPYSDR       600
     NFIGAFVTRN F                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page