(data stored in ACNUC7421 zone)

EMBL: CP001069.PE55

CP001069.PE55        Location/Qualifiers
FT   CDS             66041..66868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3817"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: rso:RS02005 probable oxacillin hydrolase (class-D
FT                   beta-lactamase) signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3817"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28931"
FT                   /db_xref="GOA:B2UH80"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH80"
FT                   /protein_id="ACD28931.1"
FT                   /translation="MMKLRHAATGALLAALATFAHAEHPICTIVADAATGTVVLHEGKC
FT                   DERVTPASTFKLALAVMGFDHGFLKDEHTPVEHFRRGDPDWGGEAWHQPIDPALWLQYS
FT                   VVWYSQRITHAMGAQTFQAYVRKLGYGNMDVSGDPGKHNGMDRSWITSSLKISPQEQVD
FT                   FMRRIVNRQLPVSAHTYEMVDRTVQTWQVPGGWAVQGKTGTAGPAPGNTSPDGTWDQAH
FT                   AYGWFVGWAKKGDKTYVFANLIQDDKVEPTSGGIRSRDALLARLPEVLAFAGH"
     MMKLRHAATG ALLAALATFA HAEHPICTIV ADAATGTVVL HEGKCDERVT PASTFKLALA        60
     VMGFDHGFLK DEHTPVEHFR RGDPDWGGEA WHQPIDPALW LQYSVVWYSQ RITHAMGAQT       120
     FQAYVRKLGY GNMDVSGDPG KHNGMDRSWI TSSLKISPQE QVDFMRRIVN RQLPVSAHTY       180
     EMVDRTVQTW QVPGGWAVQG KTGTAGPAPG NTSPDGTWDQ AHAYGWFVGW AKKGDKTYVF       240
     ANLIQDDKVE PTSGGIRSRD ALLARLPEVL AFAGH                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page