(data stored in SCRATCH zone)

EMBL: CP001069.PE551

CP001069.PE551       Location/Qualifiers
FT   CDS             638892..639158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5824 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4332"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29427"
FT                   /db_xref="GOA:B2UIM6"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM6"
FT                   /protein_id="ACD29427.1"
FT                   /translation="MNTNTTTKSRGRGKRILVLGGALLLAAVVVGGVMYGPEFYGLLQF
FT                   GKQLDQITQEDTRVGGPWPRVSEVCVSCHGYEGSCQDKANSLS"
     MNTNTTTKSR GRGKRILVLG GALLLAAVVV GGVMYGPEFY GLLQFGKQLD QITQEDTRVG        60
     GPWPRVSEVC VSCHGYEGSC QDKANSLS                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page