(data stored in SCRATCH zone)

EMBL: CP001069.PE552

CP001069.PE552       Location/Qualifiers
FT   CDS             639276..642275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4333"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   bvi:Bcep1808_7171 transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29428"
FT                   /db_xref="GOA:B2UE95"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE95"
FT                   /protein_id="ACD29428.1"
FT                   /translation="MATVERTAYPRFPKVFSTKELQACYTPTAEELDWATRSTRGQSPR
FT                   LGLLVLLKIFQQLHYFPYLDAIPTAVVDHVRVCAGLDPDTPFGYDRKVSPTLFRHYVVV
FT                   RQFLGVQPYIGTDANEVTIRAAREAAETMDQPVDIINATIDALILQQVELPAFSTLDTI
FT                   VEQIHARTQNAMFRRVARRLSEEDRQRLDKLLTREFANRQTAYNNIKRHARRPSRKHLN
FT                   LLIEHLEWLDSFGDLSGVLEGVPATKLRSLANQAMGLDAANLKETLPEKRYTLIVALLA
FT                   HMRVRSRDDLAEMFIRRMGAIHKRAQDELEYIQSRQRAKLEGLVTVLDGVVDIVADGGD
FT                   DARIGAQVRKLLAPNGDLEPLRERCAEVRAFSGNNYLPLLWRHFRAHRSVMLRLARVLE
FT                   WESTSQSRTLLAGLEVALENESLHREWIAAEVDLSFASERWRKLVRRAHHEGPPTNRRY
FT                   LELCVLSHMVNELRSGDLCVVGSDAFADYRGHLLPWRECERRLPEYCAKLDLPANAQEF
FT                   VAHLKQWLADAAQTLDKSFPDKRQHVTISADGEPLLKRTAARETPPSAVALQQALIRRM
FT                   PTRNLLDVLANIEHWTQFTRHFGPLSGNDPKIRNAAERYLLTIFAMGCNLGPTQAARHM
FT                   GDRVTPHMMSFVNRRHMSLEKLETAQRELIELYLRLDLPKHWGDGKTVAADGTQYDFYD
FT                   NNLLAGYHFRYHKMGAVAYRHVADNYIAVFRHFIPPGVWEAIYVIEGLLKANLSVEADT
FT                   VHADTQGQSAAVFAFTHLLGINLMPRIRNWKELDLYKPDAGVKYKHIDSLFSAVVDWDL
FT                   IAFHWQDLMQVALSIQAGTISSPLLLRRLGSESRKNRLYLAARELGNVVRTVYLLEWVG
FT                   SRELRQEVTATTNKIESYNGFAKWFSFGGDVIAENEPEEQQKRLRYNDLIASAVILQNT
FT                   ADLMQALRTMVSEGIKVNVADIEFLSPYLTHNIKRFGDYKLHLERVPEAWIRDGLFAGP
FT                   ARAVRRARHA"
     MATVERTAYP RFPKVFSTKE LQACYTPTAE ELDWATRSTR GQSPRLGLLV LLKIFQQLHY        60
     FPYLDAIPTA VVDHVRVCAG LDPDTPFGYD RKVSPTLFRH YVVVRQFLGV QPYIGTDANE       120
     VTIRAAREAA ETMDQPVDII NATIDALILQ QVELPAFSTL DTIVEQIHAR TQNAMFRRVA       180
     RRLSEEDRQR LDKLLTREFA NRQTAYNNIK RHARRPSRKH LNLLIEHLEW LDSFGDLSGV       240
     LEGVPATKLR SLANQAMGLD AANLKETLPE KRYTLIVALL AHMRVRSRDD LAEMFIRRMG       300
     AIHKRAQDEL EYIQSRQRAK LEGLVTVLDG VVDIVADGGD DARIGAQVRK LLAPNGDLEP       360
     LRERCAEVRA FSGNNYLPLL WRHFRAHRSV MLRLARVLEW ESTSQSRTLL AGLEVALENE       420
     SLHREWIAAE VDLSFASERW RKLVRRAHHE GPPTNRRYLE LCVLSHMVNE LRSGDLCVVG       480
     SDAFADYRGH LLPWRECERR LPEYCAKLDL PANAQEFVAH LKQWLADAAQ TLDKSFPDKR       540
     QHVTISADGE PLLKRTAARE TPPSAVALQQ ALIRRMPTRN LLDVLANIEH WTQFTRHFGP       600
     LSGNDPKIRN AAERYLLTIF AMGCNLGPTQ AARHMGDRVT PHMMSFVNRR HMSLEKLETA       660
     QRELIELYLR LDLPKHWGDG KTVAADGTQY DFYDNNLLAG YHFRYHKMGA VAYRHVADNY       720
     IAVFRHFIPP GVWEAIYVIE GLLKANLSVE ADTVHADTQG QSAAVFAFTH LLGINLMPRI       780
     RNWKELDLYK PDAGVKYKHI DSLFSAVVDW DLIAFHWQDL MQVALSIQAG TISSPLLLRR       840
     LGSESRKNRL YLAARELGNV VRTVYLLEWV GSRELRQEVT ATTNKIESYN GFAKWFSFGG       900
     DVIAENEPEE QQKRLRYNDL IASAVILQNT ADLMQALRTM VSEGIKVNVA DIEFLSPYLT       960
     HNIKRFGDYK LHLERVPEAW IRDGLFAGPA RAVRRARHA                              999
//

If you have problems or comments...

PBIL Back to PBIL home page