(data stored in ACNUC7421 zone)

EMBL: CP001069.PE557

CP001069.PE557       Location/Qualifiers
FT   CDS             complement(644928..645191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4338"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: smd:Smed_6450 transcriptional regulator,
FT                   CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4338"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29433"
FT                   /db_xref="GOA:B2UEA0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEA0"
FT                   /protein_id="ACD29433.1"
FT                   /translation="MSKAETRVLTAHVPVPLAEKVDQLADRLERSRGWIMKQALSAWIA
FT                   QEEERDRLTREALADVDAGRVIGHQAVQAWADSLGAGEPVPR"
     MSKAETRVLT AHVPVPLAEK VDQLADRLER SRGWIMKQAL SAWIAQEEER DRLTREALAD        60
     VDAGRVIGHQ AVQAWADSLG AGEPVPR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page