(data stored in ACNUC7421 zone)

EMBL: CP001069.PE558

CP001069.PE558       Location/Qualifiers
FT   CDS             complement(645243..645974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll4023 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4339"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29434"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:B2UEA1"
FT                   /protein_id="ACD29434.1"
FT                   /translation="MTPNLMNLSDMPSTGTGWDRLEAAFKEERPLQPIRKIVVKGSVDM
FT                   VFRRADTPTLVVAGETADAVTSVRTAYKGDKLVIEREGVSIRFGSSHMTFHGTVGSVVL
FT                   GDIVNGKPTGPAISLHQPRAVVGIALPEFPAIKIKGSGDVTLLDLQQDALDLEIPGSGD
FT                   ITASGHVARLHVQVVGSGDVDASALIAESADLSVAGSGDIDAFVRTEVRARVAGSGDIV
FT                   VRGNPLRWDDHVAGSGTIKFR"
     MTPNLMNLSD MPSTGTGWDR LEAAFKEERP LQPIRKIVVK GSVDMVFRRA DTPTLVVAGE        60
     TADAVTSVRT AYKGDKLVIE REGVSIRFGS SHMTFHGTVG SVVLGDIVNG KPTGPAISLH       120
     QPRAVVGIAL PEFPAIKIKG SGDVTLLDLQ QDALDLEIPG SGDITASGHV ARLHVQVVGS       180
     GDVDASALIA ESADLSVAGS GDIDAFVRTE VRARVAGSGD IVVRGNPLRW DDHVAGSGTI       240
     KFR                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page