(data stored in ACNUC7421 zone)

EMBL: CP001069.PE56

CP001069.PE56        Location/Qualifiers
FT   CDS             complement(66878..67603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3818"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bpt:Bpet1842
FT                   transcriptional regulator, ArsR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3818"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28932"
FT                   /db_xref="GOA:B2UH81"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH81"
FT                   /protein_id="ACD28932.1"
FT                   /translation="MSHPNSFSGTAFLLADPARAAMLTALLDGHALPAGELAHAAGITA
FT                   QTASTHLAKLLDGGLVVVETEGRHKYFRLAGEHVAQALEHLAAITPSAVVRRTTPSPTA
FT                   RELGFCRCCYDHLAGQVGVAVTQALQSHGYLLPMPDKQYEITPAGIAWFGDVGLNVQDI
FT                   RPTRRGLARQCLDWTERAHHLAGPLGVHFLRRLCDAGWMLRARNSRAVLVTPKGWQELH
FT                   QRLGVDEATVRSDAGHRHA"
     MSHPNSFSGT AFLLADPARA AMLTALLDGH ALPAGELAHA AGITAQTAST HLAKLLDGGL        60
     VVVETEGRHK YFRLAGEHVA QALEHLAAIT PSAVVRRTTP SPTARELGFC RCCYDHLAGQ       120
     VGVAVTQALQ SHGYLLPMPD KQYEITPAGI AWFGDVGLNV QDIRPTRRGL ARQCLDWTER       180
     AHHLAGPLGV HFLRRLCDAG WMLRARNSRA VLVTPKGWQE LHQRLGVDEA TVRSDAGHRH       240
     A                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page