(data stored in ACNUC7421 zone)

EMBL: CP001069.PE562

CP001069.PE562       Location/Qualifiers
FT   CDS             648416..648592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4343"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29438"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN7"
FT                   /protein_id="ACD29438.1"
FT                   /translation="MVDPHDKKTRQLPLISRSRARLFDFLEYREWAFFHHGPQINFYGK
FT                   ACLHGLGGLMGVW"
     MVDPHDKKTR QLPLISRSRA RLFDFLEYRE WAFFHHGPQI NFYGKACLHG LGGLMGVW          58
//

If you have problems or comments...

PBIL Back to PBIL home page