(data stored in SCRATCH zone)

EMBL: CP001069.PE563

CP001069.PE563       Location/Qualifiers
FT   CDS             648610..648915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4344"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29439"
FT                   /db_xref="GOA:B2UIN8"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN8"
FT                   /protein_id="ACD29439.1"
FT                   /translation="MGQMGAWDAVGLVVSLACLCTVATGFVWFMHHMSPARVLDRLAQG
FT                   CGAAWLEHLRWTRKDFVSSLRMREEAYSELDGAKLDLADEFLRDDLHRLGGLAGAW"
     MGQMGAWDAV GLVVSLACLC TVATGFVWFM HHMSPARVLD RLAQGCGAAW LEHLRWTRKD        60
     FVSSLRMREE AYSELDGAKL DLADEFLRDD LHRLGGLAGA W                           101
//

If you have problems or comments...

PBIL Back to PBIL home page