(data stored in ACNUC7421 zone)

EMBL: CP001069.PE566

CP001069.PE566       Location/Qualifiers
FT   CDS             649516..651111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dme:Dmel_CG31439 CG31439"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4347"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29442"
FT                   /db_xref="GOA:B2UIP1"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP1"
FT                   /protein_id="ACD29442.1"
FT                   /translation="MDALRSVVGAALRWCGHVGLWLLKRVLFVVAVVTALGLLGRSAHA
FT                   AGCTVPGQMCIQGNSMGVDVSVRQSGNGTPQTPSAGVMNVLVPITVGVVAVGAAAVAIP
FT                   AVGGIAIAGDAMASVGMTAIRGGIIGGVALTSLLNYLGGDMVMGPDGKVSKAQHNASQG
FT                   DSGFDGALWISGNKTGDSPVAACSAYVAVAYPGMSITGYGGNGYCQGTLPPGSSMSCGG
FT                   GVCNIQVGHAGGCVSGYVASGSGCAVDPSSPVTYAPASDADIQSAISSHPASWPSIYND
FT                   MNCGPTLALTNGSTSDPCYGLYSDSRTGFGVSFSTGGSSWTNNGCAVNSTSCPSATVTT
FT                   APTTDSSTKTNADGSKTTTTNTTTKTTTVTGTNDRTNPVEAQTTTTTQTSTTVTNPDGS
FT                   TTTTTTTTTDQASPATAGNANQQQKDQTPATTATFAGGDWKLYTPKEKTMAQVMQAFVS
FT                   RVQAMPWYTVMSNFFTVNVSGSCPHWVVPASRYTPPLDGTQFFCASWAMSLYALGGVVT
FT                   MLVAAWYAWRIAFL"
     MDALRSVVGA ALRWCGHVGL WLLKRVLFVV AVVTALGLLG RSAHAAGCTV PGQMCIQGNS        60
     MGVDVSVRQS GNGTPQTPSA GVMNVLVPIT VGVVAVGAAA VAIPAVGGIA IAGDAMASVG       120
     MTAIRGGIIG GVALTSLLNY LGGDMVMGPD GKVSKAQHNA SQGDSGFDGA LWISGNKTGD       180
     SPVAACSAYV AVAYPGMSIT GYGGNGYCQG TLPPGSSMSC GGGVCNIQVG HAGGCVSGYV       240
     ASGSGCAVDP SSPVTYAPAS DADIQSAISS HPASWPSIYN DMNCGPTLAL TNGSTSDPCY       300
     GLYSDSRTGF GVSFSTGGSS WTNNGCAVNS TSCPSATVTT APTTDSSTKT NADGSKTTTT       360
     NTTTKTTTVT GTNDRTNPVE AQTTTTTQTS TTVTNPDGST TTTTTTTTDQ ASPATAGNAN       420
     QQQKDQTPAT TATFAGGDWK LYTPKEKTMA QVMQAFVSRV QAMPWYTVMS NFFTVNVSGS       480
     CPHWVVPASR YTPPLDGTQF FCASWAMSLY ALGGVVTMLV AAWYAWRIAF L                531
//

If you have problems or comments...

PBIL Back to PBIL home page