(data stored in ACNUC7421 zone)

EMBL: CP001069.PE567

CP001069.PE567       Location/Qualifiers
FT   CDS             651127..651456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4348"
FT                   /product="minor coat protein"
FT                   /note="KEGG: xcb:XC_2118 minor coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29443"
FT                   /db_xref="GOA:B2UIP2"
FT                   /db_xref="InterPro:IPR019670"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP2"
FT                   /protein_id="ACD29443.1"
FT                   /translation="MFDAVINALSAFANWLLSGFVAVFVALWQIEEDLFIDGFDLLLNG
FT                   FSSVLSILPTPTFLTAVSLQSLFGQLGSDALFFVGQFRVGEGLALVGAAFAFRMARKVV
FT                   TLFQW"
     MFDAVINALS AFANWLLSGF VAVFVALWQI EEDLFIDGFD LLLNGFSSVL SILPTPTFLT        60
     AVSLQSLFGQ LGSDALFFVG QFRVGEGLAL VGAAFAFRMA RKVVTLFQW                   109
//

If you have problems or comments...

PBIL Back to PBIL home page