(data stored in SCRATCH zone)

EMBL: CP001069.PE568

CP001069.PE568       Location/Qualifiers
FT   CDS             651461..652792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4349"
FT                   /product="Zonular occludens toxin"
FT                   /note="PFAM: Zonular occludens toxin; KEGG: xcb:XC_2117 pI
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29444"
FT                   /db_xref="GOA:B2UIP3"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP3"
FT                   /protein_id="ACD29444.1"
FT                   /translation="MFIFHEGLPRSGKSYEAMVKRIIPALLKGRKVYARLNGINHEKVA
FT                   EAAGMPVEQVRALLFEIPESKVLLWHTIVENDSLVILDEMQNFWPESVRNIPQDQLKAI
FT                   TEHGHRGLDIVGMGQLLKGKGGVNANWVNRCDQKIVFEKQNAQGRDDHYRWTSYKGKLE
FT                   NGRIKFVKIASEVEKYDPKYFGTYATRVEGAENAETYKDDRTNILRSRLFRLWVPLGVV
FT                   AFAVCLGYLWHLLRGGGMEKSLLKNQPQHNVVTTTSTVSTPASGVVATSAQPMQQPSQA
FT                   AATTQPAKADALADDYIVAITGKWRPRLSGLIVGGRKARVVVEWYDDGYRVRERLSAAQ
FT                   LEEFGWLVVRSAYGEHVVLSKQGTHIAVTAWPMEPYAAVSEVQQGEIRNAGRNVGFGGG
FT                   EAPVPYGDVRQVAAAGGGDDPSWNGYGADGLIRHHKPVHSILSN"
     MFIFHEGLPR SGKSYEAMVK RIIPALLKGR KVYARLNGIN HEKVAEAAGM PVEQVRALLF        60
     EIPESKVLLW HTIVENDSLV ILDEMQNFWP ESVRNIPQDQ LKAITEHGHR GLDIVGMGQL       120
     LKGKGGVNAN WVNRCDQKIV FEKQNAQGRD DHYRWTSYKG KLENGRIKFV KIASEVEKYD       180
     PKYFGTYATR VEGAENAETY KDDRTNILRS RLFRLWVPLG VVAFAVCLGY LWHLLRGGGM       240
     EKSLLKNQPQ HNVVTTTSTV STPASGVVAT SAQPMQQPSQ AAATTQPAKA DALADDYIVA       300
     ITGKWRPRLS GLIVGGRKAR VVVEWYDDGY RVRERLSAAQ LEEFGWLVVR SAYGEHVVLS       360
     KQGTHIAVTA WPMEPYAAVS EVQQGEIRNA GRNVGFGGGE APVPYGDVRQ VAAAGGGDDP       420
     SWNGYGADGL IRHHKPVHSI LSN                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page