(data stored in SCRATCH zone)

EMBL: CP001069.PE572

CP001069.PE572       Location/Qualifiers
FT   CDS             657655..658620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4353"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bvi:Bcep1808_5897 putative transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4353"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29448"
FT                   /db_xref="GOA:B2UIP7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP7"
FT                   /protein_id="ACD29448.1"
FT                   /translation="MKRLYKSLAPRHYRSGEAAKLARMSASTLRIWERKYAVVAPPKSA
FT                   SGQRLYTEEDIERLRLIRGLVDSGHAIGAVASLNVESLRALVRSSGTVHAAKGEPISLL
FT                   MVGPVPIAIANSASDSMYVCGHPGSLEEAFRDARAGLRADALLVAVPSLTEDTILRIVA
FT                   LAEAAHAKAISVIFTSGTPRAIERASLGGLRVVPQSDAEVRPESLIAELVDWATALRQA
FT                   DILNADTRSRAARRFDDKALAAFAGLTSTIQCECPRHLAELVIQLSAFQRYSDACLSRS
FT                   PRDALLHRRLGNVANRAVQLLETALAEVVRHEDLLNSAKR"
     MKRLYKSLAP RHYRSGEAAK LARMSASTLR IWERKYAVVA PPKSASGQRL YTEEDIERLR        60
     LIRGLVDSGH AIGAVASLNV ESLRALVRSS GTVHAAKGEP ISLLMVGPVP IAIANSASDS       120
     MYVCGHPGSL EEAFRDARAG LRADALLVAV PSLTEDTILR IVALAEAAHA KAISVIFTSG       180
     TPRAIERASL GGLRVVPQSD AEVRPESLIA ELVDWATALR QADILNADTR SRAARRFDDK       240
     ALAAFAGLTS TIQCECPRHL AELVIQLSAF QRYSDACLSR SPRDALLHRR LGNVANRAVQ       300
     LLETALAEVV RHEDLLNSAK R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page