(data stored in ACNUC7421 zone)

EMBL: CP001069.PE575

CP001069.PE575       Location/Qualifiers
FT   CDS             659967..660443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4356"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: rso:RSc1996 putative transmembrane succinate
FT                   dehydrogenase (cytochrome b-556 subunit) oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4356"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29451"
FT                   /db_xref="GOA:B2UIQ0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ0"
FT                   /protein_id="ACD29451.1"
FT                   /translation="MLRQTKQSHLLRNLFEVCLEDHVAIDSKNGAVIYRNIGLGDIARY
FT                   RLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEISFAKFSALLSNGFAKVVVLAL
FT                   IWAYLHHFCAGVRYLILDLHIGIDKASASKSAVSVLIVSLLLTVVFGAKLFGLF"
     MLRQTKQSHL LRNLFEVCLE DHVAIDSKNG AVIYRNIGLG DIARYRLPWA GKVSILHRAS        60
     GALMFLLLPF VLYLFEQSLT SEISFAKFSA LLSNGFAKVV VLALIWAYLH HFCAGVRYLI       120
     LDLHIGIDKA SASKSAVSVL IVSLLLTVVF GAKLFGLF                               158
//

If you have problems or comments...

PBIL Back to PBIL home page