(data stored in SCRATCH zone)

EMBL: CP001069.PE576

CP001069.PE576       Location/Qualifiers
FT   CDS             660454..660819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4357"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="TIGRFAM: succinate dehydrogenase, hydrophobic
FT                   membrane anchor protein; PFAM: succinate dehydrogenase
FT                   cytochrome b subunit; KEGG: rso:RSc1995 putative
FT                   transmembrane succinate dehydrogenase (hydrophobic membrane
FT                   anchor subunit) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4357"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29452"
FT                   /db_xref="GOA:B2U702"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2U702"
FT                   /protein_id="ACD29452.1"
FT                   /translation="MANNNIGPKRLVVGAHYGLKDFLAQRVTAVIMAVYTVVLLAAFLL
FT                   SKDTSYQSWAGLFSNQWMKMLTFLAFVSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTI
FT                   LWLVGCAGYAAQILWRV"
     MANNNIGPKR LVVGAHYGLK DFLAQRVTAV IMAVYTVVLL AAFLLSKDTS YQSWAGLFSN        60
     QWMKMLTFLA FVSLTYHAWI GVRDIWMDYV KPVAVRLTLQ VLTILWLVGC AGYAAQILWR       120
     V                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page