(data stored in SCRATCH zone)

EMBL: CP001069.PE579

CP001069.PE579       Location/Qualifiers
FT   CDS             complement(663476..664207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4360"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29455"
FT                   /db_xref="GOA:B2UIQ4"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ4"
FT                   /protein_id="ACD29455.1"
FT                   /translation="MTPDRDLECAEYVLGLLDTEERSAVERALHEDAALQAAVDAWESR
FT                   LSPLGEAVTSRQPPARVWRRIEADLGLVERTGAPTTLPAGAQMRRFWNSIRFWRTLALA
FT                   TTFAMVAVVAVNLFLAAPTEAPSGLKSAYAAAAIADDDGVPHWTATVDKAKREIIVVPA
FT                   VAFQVSDSASTELWLIPENSKPISLGVFPSNRSTSIVLSKENAAKLNARSALAVSVEPK
FT                   GGSPTGQATGPVVGKGAMHET"
     MTPDRDLECA EYVLGLLDTE ERSAVERALH EDAALQAAVD AWESRLSPLG EAVTSRQPPA        60
     RVWRRIEADL GLVERTGAPT TLPAGAQMRR FWNSIRFWRT LALATTFAMV AVVAVNLFLA       120
     APTEAPSGLK SAYAAAAIAD DDGVPHWTAT VDKAKREIIV VPAVAFQVSD SASTELWLIP       180
     ENSKPISLGV FPSNRSTSIV LSKENAAKLN ARSALAVSVE PKGGSPTGQA TGPVVGKGAM       240
     HET                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page