(data stored in ACNUC7421 zone)

EMBL: CP001069.PE58

CP001069.PE58        Location/Qualifiers
FT   CDS             69918..70097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3820"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_1023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3820"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28934"
FT                   /db_xref="GOA:B2UH83"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH83"
FT                   /protein_id="ACD28934.1"
FT                   /translation="MKFLLALPFIGLLWVPFYNQELPSLFGFPFFYWYQFLWVPITSLL
FT                   IWIVFKNGQSQGEE"
     MKFLLALPFI GLLWVPFYNQ ELPSLFGFPF FYWYQFLWVP ITSLLIWIVF KNGQSQGEE         59
//

If you have problems or comments...

PBIL Back to PBIL home page