(data stored in SCRATCH zone)

EMBL: CP001069.PE582

CP001069.PE582       Location/Qualifiers
FT   CDS             666070..666651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3162 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4363"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29458"
FT                   /db_xref="GOA:B2UIQ7"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ7"
FT                   /protein_id="ACD29458.1"
FT                   /translation="MKRALLLVLTLTTATLSACGGGDDTPMAMASTASTAQFPQNADMW
FT                   AGLGGDASAPAAISKVVDDAVSGLLADPKEAPYFANIGKPGHDTVGRLKACLNLQFKAL
FT                   FGGPFSYPGQVAADGTTVMCDDMATAHSDVGIPGCVFDQFITDAAAVMKTDGVPDGYIS
FT                   RVAPVLTGLKSTIVSTMPQYLGPNTAQNCK"
     MKRALLLVLT LTTATLSACG GGDDTPMAMA STASTAQFPQ NADMWAGLGG DASAPAAISK        60
     VVDDAVSGLL ADPKEAPYFA NIGKPGHDTV GRLKACLNLQ FKALFGGPFS YPGQVAADGT       120
     TVMCDDMATA HSDVGIPGCV FDQFITDAAA VMKTDGVPDG YISRVAPVLT GLKSTIVSTM       180
     PQYLGPNTAQ NCK                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page