(data stored in SCRATCH zone)

EMBL: CP001069.PE588

CP001069.PE588       Location/Qualifiers
FT   CDS             complement(671732..672436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4369"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bte:BTH_II0062 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29464"
FT                   /db_xref="GOA:B2UIR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR3"
FT                   /protein_id="ACD29464.1"
FT                   /translation="METVFNIQAVSKVYPMGSVSVRALEHVDLELGPGEIVVLLGASGS
FT                   GKSTLLNLMGGLDTPTSGSIVYRDHDLSHAGDRGLTRFRREHVGFVFQFYNLIPSLTAR
FT                   ENVALVTDIAEHPLDPTEALNRVGIGTLADNFPSQMSGGEQQRVAIARAVAKRPDVLLC
FT                   DEPTGALDFRTGQLVLEVLEQVNREFGTLIVIVTHNAVIADMADRVVRMSSGTIVEHRR
FT                   NGQRARVGDLAW"
     METVFNIQAV SKVYPMGSVS VRALEHVDLE LGPGEIVVLL GASGSGKSTL LNLMGGLDTP        60
     TSGSIVYRDH DLSHAGDRGL TRFRREHVGF VFQFYNLIPS LTARENVALV TDIAEHPLDP       120
     TEALNRVGIG TLADNFPSQM SGGEQQRVAI ARAVAKRPDV LLCDEPTGAL DFRTGQLVLE       180
     VLEQVNREFG TLIVIVTHNA VIADMADRVV RMSSGTIVEH RRNGQRARVG DLAW             234
//

If you have problems or comments...

PBIL Back to PBIL home page