(data stored in ACNUC7421 zone)

EMBL: CP001069.PE589

CP001069.PE589       Location/Qualifiers
FT   CDS             complement(672451..672741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS00827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4370"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29465"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR4"
FT                   /protein_id="ACD29465.1"
FT                   /translation="MSAWAIEQHRGCSIHILVVVGRCDGFKYAYTGFVCSPKQAALEYP
FT                   KLERFHHVSPDFDSVDVAIAAGMQVGRAIAERWTSHSAQHQTSERPTRPPS"
     MSAWAIEQHR GCSIHILVVV GRCDGFKYAY TGFVCSPKQA ALEYPKLERF HHVSPDFDSV        60
     DVAIAAGMQV GRAIAERWTS HSAQHQTSER PTRPPS                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page