(data stored in SCRATCH zone)

EMBL: CP001069.PE590

CP001069.PE590       Location/Qualifiers
FT   CDS             complement(672975..673619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4371"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0198 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4371"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29466"
FT                   /db_xref="GOA:B2UIR5"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR5"
FT                   /protein_id="ACD29466.1"
FT                   /translation="MTNLLALFATILLLNVMPAFAPPTWMVMSWVGFSRPDANPVLLAG
FT                   IAACAATLGRLVLARLSCTLVRNRWMREADRQNIDVVRAWLEDRKGMTVGLMLAYAFSP
FT                   FPSNYIFIAYGLTGMRLWLIGLPFFVGRWISYLTWTRIAQIGARYLDVETEIDGAYMGV
FT                   YFVVSQVVFLALVYGFAKLDWQHLLQTKHLRWRRRESIASSAKDTRTKVQR"
     MTNLLALFAT ILLLNVMPAF APPTWMVMSW VGFSRPDANP VLLAGIAACA ATLGRLVLAR        60
     LSCTLVRNRW MREADRQNID VVRAWLEDRK GMTVGLMLAY AFSPFPSNYI FIAYGLTGMR       120
     LWLIGLPFFV GRWISYLTWT RIAQIGARYL DVETEIDGAY MGVYFVVSQV VFLALVYGFA       180
     KLDWQHLLQT KHLRWRRRES IASSAKDTRT KVQR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page