(data stored in SCRATCH zone)

EMBL: CP001069.PE593

CP001069.PE593       Location/Qualifiers
FT   CDS             complement(676522..677778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29469"
FT                   /db_xref="GOA:B2UIR8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR8"
FT                   /protein_id="ACD29469.1"
FT                   /translation="MRLDLFRIVLAGAGTLVLWTAVAQAQGSSSHLPSENAVREAVALS
FT                   PDVLAAEARRDAVLARAEGVRAGTAETVVRAIGQRRQVRDPSERHAEGQITVERPLRLW
FT                   GKAQADAQLADAAAEAGQLAVKDARHEASRQVLTLWFGAVRAGQARLAALENAKAAADL
FT                   AALTARRVQMGDASRLDAELAAADRARTQAMLATAAAAEQTAQAELQARFPGLGHPAFG
FT                   ADTALPPLPQDPPDRLRTQYIQDSHEYRLAMAEEAQAQQMAKRADLERRADPTVGMFVT
FT                   VERGGAERIMGVSVAMPIGSAHRRSTAVAAAADAETAARRRLGAERRLGAEFDVLYGNL
FT                   QGKRASAQAQMEAATLQKSASDRAMRAYRAGESGLTELLAARRSLAEAQLAERLARVDL
FT                   LEADSRLQLDLHRMWDFDD"
     MRLDLFRIVL AGAGTLVLWT AVAQAQGSSS HLPSENAVRE AVALSPDVLA AEARRDAVLA        60
     RAEGVRAGTA ETVVRAIGQR RQVRDPSERH AEGQITVERP LRLWGKAQAD AQLADAAAEA       120
     GQLAVKDARH EASRQVLTLW FGAVRAGQAR LAALENAKAA ADLAALTARR VQMGDASRLD       180
     AELAAADRAR TQAMLATAAA AEQTAQAELQ ARFPGLGHPA FGADTALPPL PQDPPDRLRT       240
     QYIQDSHEYR LAMAEEAQAQ QMAKRADLER RADPTVGMFV TVERGGAERI MGVSVAMPIG       300
     SAHRRSTAVA AAADAETAAR RRLGAERRLG AEFDVLYGNL QGKRASAQAQ MEAATLQKSA       360
     SDRAMRAYRA GESGLTELLA ARRSLAEAQL AERLARVDLL EADSRLQLDL HRMWDFDD         418
//

If you have problems or comments...

PBIL Back to PBIL home page