(data stored in ACNUC7421 zone)

EMBL: CP001069.PE6

CP001069.PE6         Location/Qualifiers
FT   CDS             complement(4080..4247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3766"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   rso:RS02225 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3766"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28882"
FT                   /db_xref="GOA:B2UH31"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH31"
FT                   /protein_id="ACD28882.1"
FT                   /translation="MLRYALIFFIIAVIAAVLGFGGIAAGAASIAKILFMIFVVLFVVS
FT                   LIWGLVAGRG"
     MLRYALIFFI IAVIAAVLGF GGIAAGAASI AKILFMIFVV LFVVSLIWGL VAGRG             55
//

If you have problems or comments...

PBIL Back to PBIL home page