(data stored in ACNUC7421 zone)

EMBL: CP001069.PE61

CP001069.PE61        Location/Qualifiers
FT   CDS             72406..72690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3823"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3823"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28937"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH86"
FT                   /protein_id="ACD28937.1"
FT                   /translation="MDAYPICRYKGFDVYPLVYLFDPPREWHERRPDRSYNASVLICQA
FT                   GEQPSLEHSRIFRLSATPWENIGTAKRAAAKMAEDIIDGFAPGLSMAVV"
     MDAYPICRYK GFDVYPLVYL FDPPREWHER RPDRSYNASV LICQAGEQPS LEHSRIFRLS        60
     ATPWENIGTA KRAAAKMAED IIDGFAPGLS MAVV                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page