(data stored in ACNUC7421 zone)

EMBL: CP001069.PE64

CP001069.PE64        Location/Qualifiers
FT   CDS             complement(74460..74963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3826"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: rso:RSp1128 putative arsenate reductase
FT                   (arsenical PUMP modifier) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3826"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28940"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH89"
FT                   /protein_id="ACD28940.1"
FT                   /translation="MADHTTNVLILCTHNSARSVLSEGMLNHWARTLGKDVRAYSAGSA
FT                   PSGRINPFAVEALEQAGVDTTGYRSKSWDEFVADGAPQMRIVITVCDSAAAETCPYWPG
FT                   SPVKVHWGYPDPSNAQGGDAGKRQAFELTRQAIGYRMLQLLMLPLDTLDNAALQAHLDR
FT                   ISQS"
     MADHTTNVLI LCTHNSARSV LSEGMLNHWA RTLGKDVRAY SAGSAPSGRI NPFAVEALEQ        60
     AGVDTTGYRS KSWDEFVADG APQMRIVITV CDSAAAETCP YWPGSPVKVH WGYPDPSNAQ       120
     GGDAGKRQAF ELTRQAIGYR MLQLLMLPLD TLDNAALQAH LDRISQS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page