(data stored in ACNUC7421 zone)

EMBL: CP001069.PE65

CP001069.PE65        Location/Qualifiers
FT   CDS             complement(74974..75456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3827"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: reh:H16_A2179 lactoylglutathione
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3827"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28941"
FT                   /db_xref="GOA:B2UH90"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH90"
FT                   /protein_id="ACD28941.1"
FT                   /translation="MKRFHVHVHVDDLSKSIAFYSKLFAAEPTRVESDYAKWMLDDPRI
FT                   NFAISTRGSTPGVDHLGFQVDDAAELAELKARAEAADMALLDEGETTCCYARSDKHWIT
FT                   DPQGIAWEHFHSLANIPVFSEGTQEAAPAEASACCAPRAPGGKPVGIAVKSGSSCC"
     MKRFHVHVHV DDLSKSIAFY SKLFAAEPTR VESDYAKWML DDPRINFAIS TRGSTPGVDH        60
     LGFQVDDAAE LAELKARAEA ADMALLDEGE TTCCYARSDK HWITDPQGIA WEHFHSLANI       120
     PVFSEGTQEA APAEASACCA PRAPGGKPVG IAVKSGSSCC                             160
//

If you have problems or comments...

PBIL Back to PBIL home page