(data stored in SCRATCH zone)

EMBL: CP001069.PE66

CP001069.PE66        Location/Qualifiers
FT   CDS             complement(75468..75722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3828"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: rso:RSp1129
FT                   putative arsenical resistance operon repressor
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3828"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28942"
FT                   /db_xref="GOA:B2UH91"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH91"
FT                   /protein_id="ACD28942.1"
FT                   /translation="MLVVAGPTGMTPGALAEQLDVPGATLSFHLKELMNARLVTQERDG
FT                   RNLIYRAAYDHMAALLGFLTANCCQGAACLEPSTTDCKC"
     MLVVAGPTGM TPGALAEQLD VPGATLSFHL KELMNARLVT QERDGRNLIY RAAYDHMAAL        60
     LGFLTANCCQ GAACLEPSTT DCKC                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page