(data stored in ACNUC7421 zone)

EMBL: CP001069.PE67

CP001069.PE67        Location/Qualifiers
FT   CDS             76071..76991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3829"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: rso:RSc0618
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3829"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28943"
FT                   /db_xref="GOA:B2UH92"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH92"
FT                   /protein_id="ACD28943.1"
FT                   /translation="MWFKNLQLHRLPAPWAVTPDQIEQWLAPHAFRPGNSLDMQSAGWA
FT                   SPRDDGALVYSTNRQMLLVFRAEKKLLPASVVNQVTRARAVELEEQQGFKVGRKQMREL
FT                   KEQVTDELLPRAFAIRRDTRVWIDPVNGWLVIDAAAQGVADDVRSLLVKSIDRLPITSV
FT                   QVARSPVAAMTDWLLSGEAPGGFTVDQDAELRSTGEGGATVRYVGHALEADDMRRHIEA
FT                   GKQCTRLAMTWDNRISFLLTPSLTIKRVTPLDVIKEAADATAQNDDERFESDVALMTGE
FT                   LGRMLTDLVESLGGDRHEAMHQAAA"
     MWFKNLQLHR LPAPWAVTPD QIEQWLAPHA FRPGNSLDMQ SAGWASPRDD GALVYSTNRQ        60
     MLLVFRAEKK LLPASVVNQV TRARAVELEE QQGFKVGRKQ MRELKEQVTD ELLPRAFAIR       120
     RDTRVWIDPV NGWLVIDAAA QGVADDVRSL LVKSIDRLPI TSVQVARSPV AAMTDWLLSG       180
     EAPGGFTVDQ DAELRSTGEG GATVRYVGHA LEADDMRRHI EAGKQCTRLA MTWDNRISFL       240
     LTPSLTIKRV TPLDVIKEAA DATAQNDDER FESDVALMTG ELGRMLTDLV ESLGGDRHEA       300
     MHQAAA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page