(data stored in SCRATCH zone)

EMBL: CP001069.PE68

CP001069.PE68        Location/Qualifiers
FT   CDS             complement(77049..77726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3830"
FT                   /product="putative periplasmic ligand-binding sensor
FT                   protein"
FT                   /note="KEGG: rme:Rmet_4026 putative periplasmic
FT                   ligand-binding sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3830"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28944"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH93"
FT                   /protein_id="ACD28944.1"
FT                   /translation="MSPQEQQALETFLAQLTQARAGTKDPQAEARILDAVARQPDAAYL
FT                   LVQRAMLLDQALASAQAQIATLQSQLQAAQAGRSTSFMDAASNWGSHANGATPAPGYTP
FT                   QQAAPASMPTAAQPMPSQPARGGFLSGGLGSTLGSIATTAAGVAGGALLFQGIENLFHH
FT                   NSGGGFFGQQPMLGGPSETIINNIYEGDSGRSSNLDTSSRDDGLLDTDFSDSDYSDDDS
FT                   TLI"
     MSPQEQQALE TFLAQLTQAR AGTKDPQAEA RILDAVARQP DAAYLLVQRA MLLDQALASA        60
     QAQIATLQSQ LQAAQAGRST SFMDAASNWG SHANGATPAP GYTPQQAAPA SMPTAAQPMP       120
     SQPARGGFLS GGLGSTLGSI ATTAAGVAGG ALLFQGIENL FHHNSGGGFF GQQPMLGGPS       180
     ETIINNIYEG DSGRSSNLDT SSRDDGLLDT DFSDSDYSDD DSTLI                       225
//

If you have problems or comments...

PBIL Back to PBIL home page