(data stored in ACNUC7421 zone)

EMBL: CP001069.PE70

CP001069.PE70        Location/Qualifiers
FT   CDS             80373..81155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3832"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rso:RS02008 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3832"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28946"
FT                   /db_xref="GOA:B2UH95"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH95"
FT                   /protein_id="ACD28946.1"
FT                   /translation="MATPAMLTGHHAVVTGAGRGIGAAIAAQLAAHGATLTLMGRNADV
FT                   LHATAKTLPDSARAQVVTCDVTDEASVSAAFESARAGLGPISILVNNAGQAESASFAKT
FT                   TLDQWQRMLAVNLTGTFLCTQAALPDVQASGRGRIVNIASTAGQRGYAYVSAYVAAKHG
FT                   VIGLTRSLALELAARGVTVNAVCPGYTETDIVRESIDRIVARTGRSEEEARAELVKGNP
FT                   QGRLITPDEVANAVVWLCSDGASSITGQAISVSGGEVM"
     MATPAMLTGH HAVVTGAGRG IGAAIAAQLA AHGATLTLMG RNADVLHATA KTLPDSARAQ        60
     VVTCDVTDEA SVSAAFESAR AGLGPISILV NNAGQAESAS FAKTTLDQWQ RMLAVNLTGT       120
     FLCTQAALPD VQASGRGRIV NIASTAGQRG YAYVSAYVAA KHGVIGLTRS LALELAARGV       180
     TVNAVCPGYT ETDIVRESID RIVARTGRSE EEARAELVKG NPQGRLITPD EVANAVVWLC       240
     SDGASSITGQ AISVSGGEVM                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page