(data stored in ACNUC7421 zone)

EMBL: CP001069.PE79

CP001069.PE79        Location/Qualifiers
FT   CDS             88231..89280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3841"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   reu:Reut_B4715 protein of unknown function DUF849,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3841"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28955"
FT                   /db_xref="GOA:B2UHA4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA4"
FT                   /protein_id="ACD28955.1"
FT                   /translation="MQFFDDSMLPENQEPLVIQVAPFGPQFLPSDSDDIAVSMDAQIQK
FT                   AVDCYNAGATVLHVHVREEDGKGSKRLSKFNEMLTRLREAVPNMVLQVGGSISFAPEDE
FT                   GAAAKWLSDDTRHMLAELSPRPDQVTIAINTNQMNVTELLTHDDCAGTSMAEPAYFQAY
FT                   KEMWIPSGPTFVEEHLKRLQASGIQPHFMLADVGQLETVERLIRRGHYTGPVVLNWVAI
FT                   GGGADGPNPRNMMEFINRCPQGAVLTIESLMRHVLPLNTMAIAMGLHVRVGIEDNLWGK
FT                   KGERMTSVQQVEQMVRIARELHRDVASGTDARRIYKIGEHYNGIDETLAAVGYEPNRKP
FT                   GQRGFQLAA"
     MQFFDDSMLP ENQEPLVIQV APFGPQFLPS DSDDIAVSMD AQIQKAVDCY NAGATVLHVH        60
     VREEDGKGSK RLSKFNEMLT RLREAVPNMV LQVGGSISFA PEDEGAAAKW LSDDTRHMLA       120
     ELSPRPDQVT IAINTNQMNV TELLTHDDCA GTSMAEPAYF QAYKEMWIPS GPTFVEEHLK       180
     RLQASGIQPH FMLADVGQLE TVERLIRRGH YTGPVVLNWV AIGGGADGPN PRNMMEFINR       240
     CPQGAVLTIE SLMRHVLPLN TMAIAMGLHV RVGIEDNLWG KKGERMTSVQ QVEQMVRIAR       300
     ELHRDVASGT DARRIYKIGE HYNGIDETLA AVGYEPNRKP GQRGFQLAA                   349
//

If you have problems or comments...

PBIL Back to PBIL home page