(data stored in SCRATCH zone)

EMBL: CP001069.PE8

CP001069.PE8         Location/Qualifiers
FT   CDS             6310..7407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3768"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   rso:RS02227 probable sigma-54 interacting transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28884"
FT                   /db_xref="GOA:B2UH33"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH33"
FT                   /protein_id="ACD28884.1"
FT                   /translation="MSLSEAFADEHATTAGRLPCPPSLTDMAEFDDVDPAAAQAIAIAE
FT                   PDFGHLYGRSPVMRALYNQIGKVSGTLATVLIIGESGTGKELIARTVHDMSPRADQAFI
FT                   AVNCGAISPNLIESELFGHEKGSFTGATQRHTGYFEHACGGTIFLDEITEMPVEMQVKL
FT                   LRVLETGVFMRVGGTEPIQTRARIIAATNRNLMEAVADGAFREDLMYRLAVVPLHVPPL
FT                   RDRGDDIEELALHFLAQFNAAHQTDKVFSRTALTVLHNHGWPGNVRELRNAVQRGYILG
FT                   EKTVDLDNPISSPRGPTRPTVKEGVLNLSVGVTLAEAQRAMILATLEHFHGDKRQAAKT
FT                   LGVSLKTLYNRLDLYQGAAAAGMAA"
     MSLSEAFADE HATTAGRLPC PPSLTDMAEF DDVDPAAAQA IAIAEPDFGH LYGRSPVMRA        60
     LYNQIGKVSG TLATVLIIGE SGTGKELIAR TVHDMSPRAD QAFIAVNCGA ISPNLIESEL       120
     FGHEKGSFTG ATQRHTGYFE HACGGTIFLD EITEMPVEMQ VKLLRVLETG VFMRVGGTEP       180
     IQTRARIIAA TNRNLMEAVA DGAFREDLMY RLAVVPLHVP PLRDRGDDIE ELALHFLAQF       240
     NAAHQTDKVF SRTALTVLHN HGWPGNVREL RNAVQRGYIL GEKTVDLDNP ISSPRGPTRP       300
     TVKEGVLNLS VGVTLAEAQR AMILATLEHF HGDKRQAAKT LGVSLKTLYN RLDLYQGAAA       360
     AGMAA                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page