(data stored in ACNUC7421 zone)

EMBL: CP001069.PE80

CP001069.PE80        Location/Qualifiers
FT   CDS             89396..90217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3842"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_A3610 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3842"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28956"
FT                   /db_xref="GOA:B2UHA5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA5"
FT                   /protein_id="ACD28956.1"
FT                   /translation="MKLDKKVAVVTGAAGGLGKAIALAYADAGAKLVVCDINTTALEVT
FT                   RAEIESRNAECLALHCDVGSSSAVANLFEQVDAHFGTVHVLVNNAAVIPSQPVDEQRRL
FT                   QHYAYLTTPQPRHTLGFTSSMTDDDWHRFWDVNVHGVFYCTREALKRMEPQGDGKVINI
FT                   ASIAGLAALSAHSPHYSATKGAVVAFTRSVAAEVAGANIFVNAIAPGGVHTDHFEALLQ
FT                   GIGEEKRNQLFQLVPLGRLGTPEEYASLAVYLAADGHYIAGQIISPNGGMF"
     MKLDKKVAVV TGAAGGLGKA IALAYADAGA KLVVCDINTT ALEVTRAEIE SRNAECLALH        60
     CDVGSSSAVA NLFEQVDAHF GTVHVLVNNA AVIPSQPVDE QRRLQHYAYL TTPQPRHTLG       120
     FTSSMTDDDW HRFWDVNVHG VFYCTREALK RMEPQGDGKV INIASIAGLA ALSAHSPHYS       180
     ATKGAVVAFT RSVAAEVAGA NIFVNAIAPG GVHTDHFEAL LQGIGEEKRN QLFQLVPLGR       240
     LGTPEEYASL AVYLAADGHY IAGQIISPNG GMF                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page