(data stored in ACNUC7421 zone)

EMBL: CP001069.PE82

CP001069.PE82        Location/Qualifiers
FT   CDS             complement(92176..93480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3844"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1; KEGG: rso:RSp0075
FT                   putative alpha-ketoglutarate permease transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3844"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28958"
FT                   /db_xref="GOA:B2UHA7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA7"
FT                   /protein_id="ACD28958.1"
FT                   /translation="MDTTATPHAVDPHDTRRRIFAIVGASSGNLVEWFDFYVYAFCSLY
FT                   FAPAFFPSGDRTTQLLNTAGVFAAGFLMRPIGGWLFGRIADKHGRRAAMMISVLMMCGG
FT                   SLVIAVVPTYAQIGALAPFILLLARLFQGLSVGGEYGTSATYMSEVALKGRRGFFASFQ
FT                   YVTLIGGQLCALLVLVVLQQLLTTAELKAWGWRIPFAVGALTALVSLYLRKSLQETQTV
FT                   ASRTAKGAGTIRGAWQHKGAFLRVIGFTAGGSLIFYTFTTYMQKYLVNTAGMNTKVASN
FT                   VMTAALFVYMVLQPVFGALSDRIGRRTSMLFFGVLSVLGTVPLMHALATVSSPYAAFGL
FT                   ITVALAIVSFYTSISGLIKAEMFPPEVRAMGVGLSYAIANAVFGGSAEYVALWFKKAGT
FT                   EPTFYWYVTALCALSLVVTYFMPDPSKEGYLRNEP"
     MDTTATPHAV DPHDTRRRIF AIVGASSGNL VEWFDFYVYA FCSLYFAPAF FPSGDRTTQL        60
     LNTAGVFAAG FLMRPIGGWL FGRIADKHGR RAAMMISVLM MCGGSLVIAV VPTYAQIGAL       120
     APFILLLARL FQGLSVGGEY GTSATYMSEV ALKGRRGFFA SFQYVTLIGG QLCALLVLVV       180
     LQQLLTTAEL KAWGWRIPFA VGALTALVSL YLRKSLQETQ TVASRTAKGA GTIRGAWQHK       240
     GAFLRVIGFT AGGSLIFYTF TTYMQKYLVN TAGMNTKVAS NVMTAALFVY MVLQPVFGAL       300
     SDRIGRRTSM LFFGVLSVLG TVPLMHALAT VSSPYAAFGL ITVALAIVSF YTSISGLIKA       360
     EMFPPEVRAM GVGLSYAIAN AVFGGSAEYV ALWFKKAGTE PTFYWYVTAL CALSLVVTYF       420
     MPDPSKEGYL RNEP                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page