(data stored in ACNUC7421 zone)

EMBL: CP001069.PE83

CP001069.PE83        Location/Qualifiers
FT   CDS             complement(93664..94884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3845"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS05543 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3845"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28959"
FT                   /db_xref="GOA:B2UHA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA8"
FT                   /protein_id="ACD28959.1"
FT                   /translation="MSASPASPTPSATTAPAATHSDTQGLIRLLTAGAGISVACIYLNH
FT                   PLLGLISRDLNIAPNALGVLPTLTAAGYASGIFFFGPLGDRYDRRLVILWKAVLLTLAL
FT                   IGSCLAPNLPLLAAAGFAIGLSATIAQDFVPSAAAISTDHNRNRNIGTVMTGLLIGIVS
FT                   SRVFSGIVADHFGWRAAFGVSAVAIVGLAIAVRASHFGVTPATRQPYFTLLRSLGTLFM
FT                   QHPRLRASALTQAFIGIAFSGFWSTVALHLTRSLGLSTGQAGLLGLAGAAGALGASIAG
FT                   RLSGRVAPGRIAAGGALLMAVTFASMAMFPQSLIAIVIGTLVFDVGVQAALVSHQTIIY
FT                   ALAPEARSRINAVFMTALFIGMSVGAYGASLAWNAGRWSGLMTFCASASLVALGLRALF
FT                   NARLGAH"
     MSASPASPTP SATTAPAATH SDTQGLIRLL TAGAGISVAC IYLNHPLLGL ISRDLNIAPN        60
     ALGVLPTLTA AGYASGIFFF GPLGDRYDRR LVILWKAVLL TLALIGSCLA PNLPLLAAAG       120
     FAIGLSATIA QDFVPSAAAI STDHNRNRNI GTVMTGLLIG IVSSRVFSGI VADHFGWRAA       180
     FGVSAVAIVG LAIAVRASHF GVTPATRQPY FTLLRSLGTL FMQHPRLRAS ALTQAFIGIA       240
     FSGFWSTVAL HLTRSLGLST GQAGLLGLAG AAGALGASIA GRLSGRVAPG RIAAGGALLM       300
     AVTFASMAMF PQSLIAIVIG TLVFDVGVQA ALVSHQTIIY ALAPEARSRI NAVFMTALFI       360
     GMSVGAYGAS LAWNAGRWSG LMTFCASASL VALGLRALFN ARLGAH                      406
//

If you have problems or comments...

PBIL Back to PBIL home page