(data stored in ACNUC7421 zone)

EMBL: CP001069.PE84

CP001069.PE84        Location/Qualifiers
FT   CDS             complement(94984..95820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3846"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   rso:RS05542 putative DNA-binding transcriptional regulatory
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3846"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28960"
FT                   /db_xref="GOA:B2UHA9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA9"
FT                   /protein_id="ACD28960.1"
FT                   /translation="MPDAVVPLYHQIYVVLRQQILEGKFGDGPMPGEIELARQFGASRV
FT                   TMRRVFDYLVKEGLVRRHRGMGTFVVKPDDPAAQGSAGQTLLQNIIDVGERTSAVVVEF
FT                   EDVLAPPDEAKCLEVAPGTPVKKLVRVRHLEDTPMALITTWLPLDVTSKLTLDRLANQS
FT                   LLRLIEGSGVRIDRASQVVSARLADVATAQYLDVAVGAPLLSVQRIVREMSGRPVQLLQ
FT                   GLYRPDRYEYRMELSRVGEDRARLWIDNAGHDVLGGHSEDVEDVPTPAAAGRIEHS"
     MPDAVVPLYH QIYVVLRQQI LEGKFGDGPM PGEIELARQF GASRVTMRRV FDYLVKEGLV        60
     RRHRGMGTFV VKPDDPAAQG SAGQTLLQNI IDVGERTSAV VVEFEDVLAP PDEAKCLEVA       120
     PGTPVKKLVR VRHLEDTPMA LITTWLPLDV TSKLTLDRLA NQSLLRLIEG SGVRIDRASQ       180
     VVSARLADVA TAQYLDVAVG APLLSVQRIV REMSGRPVQL LQGLYRPDRY EYRMELSRVG       240
     EDRARLWIDN AGHDVLGGHS EDVEDVPTPA AAGRIEHS                               278
//

If you have problems or comments...

PBIL Back to PBIL home page