(data stored in ACNUC7421 zone)

EMBL: CP001069.PE85

CP001069.PE85        Location/Qualifiers
FT   CDS             complement(95985..96536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3847"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: rso:RS05541
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3847"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28961"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB0"
FT                   /protein_id="ACD28961.1"
FT                   /translation="MKTPETLSTTPASDLVPSMDPPCSIAAAVSIVGEKWTLLVLREAF
FT                   SGVTRFDEFLRRTGCSSAILSSRLKALVTYGILRRVPYQEPGDRVRDAYKLTRAGVDLL
FT                   PAIVALMQWGDRYLTPDGEGPILLRDRESGTPIHVALVNALGEPVAPKNSMREPNPRYG
FT                   HGNDPASTAPAPADTSAADE"
     MKTPETLSTT PASDLVPSMD PPCSIAAAVS IVGEKWTLLV LREAFSGVTR FDEFLRRTGC        60
     SSAILSSRLK ALVTYGILRR VPYQEPGDRV RDAYKLTRAG VDLLPAIVAL MQWGDRYLTP       120
     DGEGPILLRD RESGTPIHVA LVNALGEPVA PKNSMREPNP RYGHGNDPAS TAPAPADTSA       180
     ADE                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page