(data stored in ACNUC7421 zone)

EMBL: CP001069.PE87

CP001069.PE87        Location/Qualifiers
FT   CDS             97487..97921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3849"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_B2073
FT                   glyoxalase/bleomycin resistanceprotein/dioxygenase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3849"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28963"
FT                   /db_xref="GOA:B2UHB2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB2"
FT                   /protein_id="ACD28963.1"
FT                   /translation="MSDVTPVLAPFHLAFPVHDIAAARAFYGGVLGCPEGRSAPDWVDF
FT                   NFYGHQIVAHLAPEEAGHRKTSAVDGDAVPVRHFGVVLSMPEWDAAANKLRAAGVDFII
FT                   EPHIRFKGEVGEQATMFFLDPSGNALEIKAFANMASLFAK"
     MSDVTPVLAP FHLAFPVHDI AAARAFYGGV LGCPEGRSAP DWVDFNFYGH QIVAHLAPEE        60
     AGHRKTSAVD GDAVPVRHFG VVLSMPEWDA AANKLRAAGV DFIIEPHIRF KGEVGEQATM       120
     FFLDPSGNAL EIKAFANMAS LFAK                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page