(data stored in SCRATCH zone)

EMBL: CP001069.PE88

CP001069.PE88        Location/Qualifiers
FT   CDS             97972..98844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3850"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reu:Reut_B4146 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3850"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28964"
FT                   /db_xref="GOA:B2UHB3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB3"
FT                   /protein_id="ACD28964.1"
FT                   /translation="MLRELKTFIAVARHGTFAGAGERIGLTQSAVSAQIQRLEASLGFQ
FT                   LFDRTGRSATLNAAGRDALAQAEQIVTLYDRLGDQASGNEQRGLVRIGAIASVQASFLI
FT                   DALVRFRLEFPHCRTRIVPGVSLDLLGLVDAGEIDMAVLIRPPFGVPADLEWRTLVAEP
FT                   FVLLVPDSVPGDDWRVLLGHQPFIRYDRRSFGGRRVDQFLRDQHITTHDVIELDELQGM
FT                   TQLVARGQGVALAPQTAAQGAWPPGVRAIDLGNDTFTREIGLIERPRHSRQPIAGRLAD
FT                   CIDEAARAP"
     MLRELKTFIA VARHGTFAGA GERIGLTQSA VSAQIQRLEA SLGFQLFDRT GRSATLNAAG        60
     RDALAQAEQI VTLYDRLGDQ ASGNEQRGLV RIGAIASVQA SFLIDALVRF RLEFPHCRTR       120
     IVPGVSLDLL GLVDAGEIDM AVLIRPPFGV PADLEWRTLV AEPFVLLVPD SVPGDDWRVL       180
     LGHQPFIRYD RRSFGGRRVD QFLRDQHITT HDVIELDELQ GMTQLVARGQ GVALAPQTAA       240
     QGAWPPGVRA IDLGNDTFTR EIGLIERPRH SRQPIAGRLA DCIDEAARAP                  290
//

If you have problems or comments...

PBIL Back to PBIL home page