(data stored in ACNUC7421 zone)

EMBL: CP001069.PE90

CP001069.PE90        Location/Qualifiers
FT   CDS             complement(99735..101033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3852"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS03015 putative transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3852"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28966"
FT                   /db_xref="GOA:B2UHB5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB5"
FT                   /protein_id="ACD28966.1"
FT                   /translation="MQRLARLIAPRFHYSWIALAVVFLILLCAAGTRATPSVMMLPLEH
FT                   EFGWSRSTISLAISIGIALYGLTGPFAAASMQYFGIRPTVLGALAVLVSGTALSAMMHE
FT                   PWQMVLLWGVMVGGGTGVAAITLGATVVNRWFTSHRGLAMGILTASSATGQLVFLPMMA
FT                   AVVEHYGWRPVVLIVAGALALLLPIVALLLPESPRSVGLRTYGEPADAPETSQGPRANP
FT                   ISLAMQTLVQAMRKRDFWLLFASFFICGASTNGYIGTHFIAMCADHGFSEVKGASLLAA
FT                   MGIFDLVGTTLSGWLSDRYNSRVLLFWYYGLRGLSLIYLPYAFGFEFFGLPVFAIFYGL
FT                   DWIATVPPTVRLTNDVFGKAAAPIVFGWIVAGHQLGAAFATLGAGMMRASLGNYTLSSM
FT                   ISGGLCVAGAFLVLRIHRTPKQDAGRAGQPATA"
     MQRLARLIAP RFHYSWIALA VVFLILLCAA GTRATPSVMM LPLEHEFGWS RSTISLAISI        60
     GIALYGLTGP FAAASMQYFG IRPTVLGALA VLVSGTALSA MMHEPWQMVL LWGVMVGGGT       120
     GVAAITLGAT VVNRWFTSHR GLAMGILTAS SATGQLVFLP MMAAVVEHYG WRPVVLIVAG       180
     ALALLLPIVA LLLPESPRSV GLRTYGEPAD APETSQGPRA NPISLAMQTL VQAMRKRDFW       240
     LLFASFFICG ASTNGYIGTH FIAMCADHGF SEVKGASLLA AMGIFDLVGT TLSGWLSDRY       300
     NSRVLLFWYY GLRGLSLIYL PYAFGFEFFG LPVFAIFYGL DWIATVPPTV RLTNDVFGKA       360
     AAPIVFGWIV AGHQLGAAFA TLGAGMMRAS LGNYTLSSMI SGGLCVAGAF LVLRIHRTPK       420
     QDAGRAGQPA TA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page