(data stored in ACNUC7421 zone)

EMBL: CP001069.PE92

CP001069.PE92        Location/Qualifiers
FT   CDS             101968..102939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3854"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rso:RS03013
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3854"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28968"
FT                   /db_xref="GOA:B2UHB7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB7"
FT                   /protein_id="ACD28968.1"
FT                   /translation="MTPNQVPLSPVRTAPAAGMQPSSLPAALLQAQRALDRIVLGKPLQ
FT                   IRLALACLLSRGHLLLEDLPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSIY
FT                   VKEKGAFEFHPGPLFAQVVLADEINRATPKAQSALLEAMAEGQVTHDGATYPLPEPFFV
FT                   IATQNPLNQIGTHPLPESQLDRFTMRLSLGYPDQHSERALYLGGGARQDIEPVLTAAQV
FT                   VALQAGADAVHAAPALVDYVLALVNATRTDAQVQMGLSPRAGLALLAAARAWALVDGRD
FT                   AVLPEDVQAVFTAVAAHRLLPTGGTLSATALAQRLLDTVAIP"
     MTPNQVPLSP VRTAPAAGMQ PSSLPAALLQ AQRALDRIVL GKPLQIRLAL ACLLSRGHLL        60
     LEDLPGVGKT TLAHALARTL GLQYQRVQFT SDLLPADLIG VSIYVKEKGA FEFHPGPLFA       120
     QVVLADEINR ATPKAQSALL EAMAEGQVTH DGATYPLPEP FFVIATQNPL NQIGTHPLPE       180
     SQLDRFTMRL SLGYPDQHSE RALYLGGGAR QDIEPVLTAA QVVALQAGAD AVHAAPALVD       240
     YVLALVNATR TDAQVQMGLS PRAGLALLAA ARAWALVDGR DAVLPEDVQA VFTAVAAHRL       300
     LPTGGTLSAT ALAQRLLDTV AIP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page