(data stored in ACNUC7421 zone)

EMBL: CP001069.PE93

CP001069.PE93        Location/Qualifiers
FT   CDS             102952..104025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3855"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   rso:RS03012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3855"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28969"
FT                   /db_xref="GOA:B2UHB8"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB8"
FT                   /protein_id="ACD28969.1"
FT                   /translation="MARVASVLAVPLRALGAGLAALPGVRLARTRVQRFLQRPRTPREG
FT                   RIRLDRNHVYILPTGAGASFALLLIVMLLTSLNYNVSLGFLLTFVLAGVAASAMWQTHR
FT                   NLVDLEVRGAVGEAVFAGHALNVSVALANVTSWARVGVDVSAREAAAVETSLDARDAIV
FT                   AALSFAGQPRGWFRLPRLTVSTRFPLGLFRAWSYADAPLTLLIYPAPEPAAPPLPANFV
FT                   PDPGEEPSATTPRTHVEDAVDQLRPYRPGDPLRSIAWKHSARLDTWMSRTGQQVHHAQC
FT                   VLAWDALPASMHVEQRLSRLCAWVLAAEQGMAGEAPEYTLSLPGITLGPSRGPAHRDAC
FT                   LRALALWGKPAMPEDAS"
     MARVASVLAV PLRALGAGLA ALPGVRLART RVQRFLQRPR TPREGRIRLD RNHVYILPTG        60
     AGASFALLLI VMLLTSLNYN VSLGFLLTFV LAGVAASAMW QTHRNLVDLE VRGAVGEAVF       120
     AGHALNVSVA LANVTSWARV GVDVSAREAA AVETSLDARD AIVAALSFAG QPRGWFRLPR       180
     LTVSTRFPLG LFRAWSYADA PLTLLIYPAP EPAAPPLPAN FVPDPGEEPS ATTPRTHVED       240
     AVDQLRPYRP GDPLRSIAWK HSARLDTWMS RTGQQVHHAQ CVLAWDALPA SMHVEQRLSR       300
     LCAWVLAAEQ GMAGEAPEYT LSLPGITLGP SRGPAHRDAC LRALALWGKP AMPEDAS          357
//

If you have problems or comments...

PBIL Back to PBIL home page