(data stored in SCRATCH zone)

EMBL: CP001069.PE94

CP001069.PE94        Location/Qualifiers
FT   CDS             104022..106046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3856"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   rso:RS03011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3856"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28970"
FT                   /db_xref="GOA:B2UHB9"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB9"
FT                   /protein_id="ACD28970.1"
FT                   /translation="MSLATGTPLFGPTRALTHREHGWLIAQLAIVLAPLLRALPLVTCA
FT                   VFGVLLLLRTLLWVRRAPLPGKWVLGLTGLATLLVTLALALRTGGNIGRDLSVALLGAF
FT                   LVLKLMESHTVRNGILVTQLCCFLLLSQVLFDQPPWLAATMLATAALLLRNWLLLLHPQ
FT                   ARLRVSPVRVLIRLVAMGLPCAAVLFLLFPRLDHPLWSLPRSAETGTSGISDRMAPGSI
FT                   GQLILSDELAFRADFSGTPPPLDTLYWRGMVLWRFDGQAWTAVSIRQRPARGGVPDSAD
FT                   SAGAVPDAVNYNITLEATHQRWLFALDRGVSIDARDDIGRSIDSEFISKQPLDQRMRYH
FT                   ARSRLPDRNRVDDAQPLDPFTQQLALALPPGNPQARALAAQWAGLPPAERVSAALRLFG
FT                   RAPFAYTLQPEPLQGQQIDDFLFRTHRGFCEHYAGSFVFLMRAAGVPARVVVGYLGGEV
FT                   NAMSGDIIVRQSDAHAWAEVWLAGRGWVRVDPTAAVAPQRVERGLAAAVPASEFRSRRV
FT                   EEPTWLRSVRWGLDGLISGWNRWVLGYDRTRQAQLFAWLGLDAADPRAVLWGVSAIFLL
FT                   AALPLLWQQRKPRLDPVQAQWQRLCDRLARHGCARGPAEGPIAYAERAAAQFPAAAPAL
FT                   RQAAAGYVALRYGRDDGDARARAQRFTEWRTALARVRLR"
     MSLATGTPLF GPTRALTHRE HGWLIAQLAI VLAPLLRALP LVTCAVFGVL LLLRTLLWVR        60
     RAPLPGKWVL GLTGLATLLV TLALALRTGG NIGRDLSVAL LGAFLVLKLM ESHTVRNGIL       120
     VTQLCCFLLL SQVLFDQPPW LAATMLATAA LLLRNWLLLL HPQARLRVSP VRVLIRLVAM       180
     GLPCAAVLFL LFPRLDHPLW SLPRSAETGT SGISDRMAPG SIGQLILSDE LAFRADFSGT       240
     PPPLDTLYWR GMVLWRFDGQ AWTAVSIRQR PARGGVPDSA DSAGAVPDAV NYNITLEATH       300
     QRWLFALDRG VSIDARDDIG RSIDSEFISK QPLDQRMRYH ARSRLPDRNR VDDAQPLDPF       360
     TQQLALALPP GNPQARALAA QWAGLPPAER VSAALRLFGR APFAYTLQPE PLQGQQIDDF       420
     LFRTHRGFCE HYAGSFVFLM RAAGVPARVV VGYLGGEVNA MSGDIIVRQS DAHAWAEVWL       480
     AGRGWVRVDP TAAVAPQRVE RGLAAAVPAS EFRSRRVEEP TWLRSVRWGL DGLISGWNRW       540
     VLGYDRTRQA QLFAWLGLDA ADPRAVLWGV SAIFLLAALP LLWQQRKPRL DPVQAQWQRL       600
     CDRLARHGCA RGPAEGPIAY AERAAAQFPA AAPALRQAAA GYVALRYGRD DGDARARAQR       660
     FTEWRTALAR VRLR                                                         674
//

If you have problems or comments...

PBIL Back to PBIL home page