(data stored in ACNUC7421 zone)

EMBL: CP001069.PE96

CP001069.PE96        Location/Qualifiers
FT   CDS             complement(107724..108911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3858"
FT                   /product="AcnD-accessory protein PrpF"
FT                   /note="TIGRFAM: AcnD-accessory protein PrpF; PFAM: protein
FT                   of unknown function DUF453; KEGG: rso:RS03003 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3858"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28972"
FT                   /db_xref="GOA:B2UHC1"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC1"
FT                   /protein_id="ACD28972.1"
FT                   /translation="MSHPAQVKIPATYMRGGTSKGVFFRLQDLPPAAQQPGAARDALLM
FT                   RVIGSPDPYGKQIDGMGGATSSTSKTVILSKSTRPDHDVDYLFGQVSIDKPFVDWSGNC
FT                   GNLSAAVGPFAISNGLVDASRVPQNGTAIVRIWQANIGKTIIAHVPITNGAVQETGDFE
FT                   LDGVTFPAAEVQLEFLDPAAEEDGDGGGAMFPTGNLVDDLDVPGVGTLKATMINAGIPT
FT                   IFINAEAIGYTGTELQDAINGDAKALAMFETIRAHGAVRMGLIKSIDEAATRQHTPKVA
FT                   FVAPPKDYVASSGKQVGAGDVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLA
FT                   AGGGERGAVRFGHPSGTLRVGAEAKLVDGEWTVTKAIMSRSARVLMEGWVRVPGA"
     MSHPAQVKIP ATYMRGGTSK GVFFRLQDLP PAAQQPGAAR DALLMRVIGS PDPYGKQIDG        60
     MGGATSSTSK TVILSKSTRP DHDVDYLFGQ VSIDKPFVDW SGNCGNLSAA VGPFAISNGL       120
     VDASRVPQNG TAIVRIWQAN IGKTIIAHVP ITNGAVQETG DFELDGVTFP AAEVQLEFLD       180
     PAAEEDGDGG GAMFPTGNLV DDLDVPGVGT LKATMINAGI PTIFINAEAI GYTGTELQDA       240
     INGDAKALAM FETIRAHGAV RMGLIKSIDE AATRQHTPKV AFVAPPKDYV ASSGKQVGAG       300
     DVDLLVRALS MGKLHHAMMG TAAVAIGTAA AIPGTLVNLA AGGGERGAVR FGHPSGTLRV       360
     GAEAKLVDGE WTVTKAIMSR SARVLMEGWV RVPGA                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page