(data stored in ACNUC30630 zone)

EMBL: CP001096.PE105

CP001096.PE105       Location/Qualifiers
FT   CDS             complement(114274..115254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0105"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mrd:Mrad2831_4763
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98667"
FT                   /db_xref="GOA:B3Q638"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q638"
FT                   /protein_id="ACE98667.1"
FT                   /translation="MALLTHLFGKLANAVALLLAVLVMNFCLIHLAPGDPVQVIAGEMG
FT                   GASPEVIAALRAKYGLDHSLLEQMFTYLGKVAHGDFGYSYYFNQPVLGLILQRLPATLY
FT                   LAAASLVVAVLIGTVLGVISARRPNGLLSHGVTVLSLAGHAAPIFWTGLLLLLLFGSVW
FT                   PILPVNGMTDVVNPKTGFAYAADVAKHLVLPSITLGLVFVAQYSRLARVNMIDVLSADY
FT                   IRTARAKGLPERVVLVKHALRNTLIPIVTVVGLQFGNLFAGAVLVETVYSWPGMGRLVF
FT                   DSILRRDYPTLMGVLFFSAVMVIAANILTDLVYRLIDPRIRAGAR"
     MALLTHLFGK LANAVALLLA VLVMNFCLIH LAPGDPVQVI AGEMGGASPE VIAALRAKYG        60
     LDHSLLEQMF TYLGKVAHGD FGYSYYFNQP VLGLILQRLP ATLYLAAASL VVAVLIGTVL       120
     GVISARRPNG LLSHGVTVLS LAGHAAPIFW TGLLLLLLFG SVWPILPVNG MTDVVNPKTG       180
     FAYAADVAKH LVLPSITLGL VFVAQYSRLA RVNMIDVLSA DYIRTARAKG LPERVVLVKH       240
     ALRNTLIPIV TVVGLQFGNL FAGAVLVETV YSWPGMGRLV FDSILRRDYP TLMGVLFFSA       300
     VMVIAANILT DLVYRLIDPR IRAGAR                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page