(data stored in ACNUC30630 zone)

EMBL: CP001096.PE107

CP001096.PE107       Location/Qualifiers
FT   CDS             complement(116974..117930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0107"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: mrd:Mrad2831_4765
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98669"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q640"
FT                   /protein_id="ACE98669.1"
FT                   /translation="MTAASATISVTVIGGFLGAGKTTFVNHLLRSGGPRTAVLVNDFGE
FT                   VNVDATLIQSHDGTTMTLTNGCICCSIGTSFIDTMCQVLDAAVPFERIVIEASGVGDPW
FT                   KIAEIALIEPSLRLDRVIVLADASRIAQLIEDSKVGDTVRGQFERCDIVLLNKTDLVNA
FT                   EALTAARTAVRSLRLDVGIVATAQGAMPTLAELKTAASSSGFRADAVDAAAIDHGATFK
FT                   SWAYRRAGRFDRVRLACAVDKLPPQLLRLKGSCRLAGEDDVKVFQMVESVWSLSPADAG
FT                   PVEPGIVLVGVGTADLPPPAELDAILDRALAPAGALS"
     MTAASATISV TVIGGFLGAG KTTFVNHLLR SGGPRTAVLV NDFGEVNVDA TLIQSHDGTT        60
     MTLTNGCICC SIGTSFIDTM CQVLDAAVPF ERIVIEASGV GDPWKIAEIA LIEPSLRLDR       120
     VIVLADASRI AQLIEDSKVG DTVRGQFERC DIVLLNKTDL VNAEALTAAR TAVRSLRLDV       180
     GIVATAQGAM PTLAELKTAA SSSGFRADAV DAAAIDHGAT FKSWAYRRAG RFDRVRLACA       240
     VDKLPPQLLR LKGSCRLAGE DDVKVFQMVE SVWSLSPADA GPVEPGIVLV GVGTADLPPP       300
     AELDAILDRA LAPAGALS                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page