(data stored in ACNUC30630 zone)

EMBL: CP001096.PE111

CP001096.PE111       Location/Qualifiers
FT   CDS             complement(122594..123634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0111"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   gme:Gmet_2235 alcohol dehydrogenase superfamily,
FT                   zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98673"
FT                   /db_xref="GOA:B3Q644"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q644"
FT                   /protein_id="ACE98673.1"
FT                   /translation="MKAAVFEKTGERLVVRDVAAPALGDNELLLKVAFTGICGSDLHAA
FT                   ETPGMLQSGTVMGHEFTGEIVQSTAPDWPVGARVAANPYWLCDACAAGGSCSGGGDAAC
FT                   ANGSFMGFRPDLPGAYADYVRIRAGQAIRLPDKVSLRDGALMEPLAVARHAVDVCGPMQ
FT                   GADVLVIGGGPIGLGVVLMARDAGAARVVVSEPDPNRRACALQVGAVAAIDPIAEDLPT
FT                   ALGGLGLGAPGIVFECVGAPGFLQQTIDVMALRGRAVIVGVCMTEDRVLPRAAIRKEAT
FT                   LKFVLGYTMADFHHVSRYLEEHAATAAAMISRVVSLSELPEIFDRLRAEKSLIKVLVRP
FT                   DQGSGT"
     MKAAVFEKTG ERLVVRDVAA PALGDNELLL KVAFTGICGS DLHAAETPGM LQSGTVMGHE        60
     FTGEIVQSTA PDWPVGARVA ANPYWLCDAC AAGGSCSGGG DAACANGSFM GFRPDLPGAY       120
     ADYVRIRAGQ AIRLPDKVSL RDGALMEPLA VARHAVDVCG PMQGADVLVI GGGPIGLGVV       180
     LMARDAGAAR VVVSEPDPNR RACALQVGAV AAIDPIAEDL PTALGGLGLG APGIVFECVG       240
     APGFLQQTID VMALRGRAVI VGVCMTEDRV LPRAAIRKEA TLKFVLGYTM ADFHHVSRYL       300
     EEHAATAAAM ISRVVSLSEL PEIFDRLRAE KSLIKVLVRP DQGSGT                      346
//

If you have problems or comments...

PBIL Back to PBIL home page