(data stored in ACNUC30630 zone)

EMBL: CP001096.PE115

CP001096.PE115       Location/Qualifiers
FT   CDS             complement(127157..127945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0115"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mrd:Mrad2831_4756 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98677"
FT                   /db_xref="GOA:B3Q648"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q648"
FT                   /protein_id="ACE98677.1"
FT                   /translation="MHELIAEASASFLSTLPSPMAIVGVLSAVLAAALLRGFTGFGFAL
FT                   AAVPLMGMFMPPAKAVPVAVLLQLLGGLNDLRRNHRDAHWASLRWLIVGAVIGSPIGAL
FT                   ALSVAPAPVARIVIATITAAAVVVLGRGFAIEKIPSRPVTTAVGMLCGLFNGLAAMPSP
FT                   PAIVYYMSGPFRAVAVRASLLVFFLATSIAGFTSIALVGLATVNVLWLAAMALPVMMLG
FT                   TWIGEQGFRRGTERLHRRVSIASLGGVALLSAAKGLSELM"
     MHELIAEASA SFLSTLPSPM AIVGVLSAVL AAALLRGFTG FGFALAAVPL MGMFMPPAKA        60
     VPVAVLLQLL GGLNDLRRNH RDAHWASLRW LIVGAVIGSP IGALALSVAP APVARIVIAT       120
     ITAAAVVVLG RGFAIEKIPS RPVTTAVGML CGLFNGLAAM PSPPAIVYYM SGPFRAVAVR       180
     ASLLVFFLAT SIAGFTSIAL VGLATVNVLW LAAMALPVMM LGTWIGEQGF RRGTERLHRR       240
     VSIASLGGVA LLSAAKGLSE LM                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page