(data stored in ACNUC30630 zone)

EMBL: CP001096.PE120

CP001096.PE120       Location/Qualifiers
FT   CDS             132295..133356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0120"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: azc:AZC_1833
FT                   dTDP-D-glucose-4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98682"
FT                   /db_xref="GOA:B3Q6Z4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z4"
FT                   /protein_id="ACE98682.1"
FT                   /translation="MTKRFLVTGGAGFIGSAVVRRLIGTTPHEVLVVDKLTYAGNLDSL
FT                   APVSDDPRFRFVRADIVEQGTMRLLFEEFSPDVVMHLAAESHVDRSIDGPGDFIQTNIV
FT                   GTYSLLQAALAHWRSLPAARKSGFRFHHISTDEVFGSLGAEGLFREDTPYQPKSPYSAS
FT                   KAGSDHLVRAWHHTYGLPVVITNCSNNYGPYHFPEKLIPLAIIKALHGEAIPVYGTGAN
FT                   VRDWLHVEDHADALLLAAERGENGESYNIGGRNERTNLEVVQAICRLLDELAPDAAIGS
FT                   RAKLISFVADRPGHDARYAIDASKVERELGWRARYNFDDGLRQTVQWYLDNRTWWERVR
FT                   SGVYRGERLGVAV"
     MTKRFLVTGG AGFIGSAVVR RLIGTTPHEV LVVDKLTYAG NLDSLAPVSD DPRFRFVRAD        60
     IVEQGTMRLL FEEFSPDVVM HLAAESHVDR SIDGPGDFIQ TNIVGTYSLL QAALAHWRSL       120
     PAARKSGFRF HHISTDEVFG SLGAEGLFRE DTPYQPKSPY SASKAGSDHL VRAWHHTYGL       180
     PVVITNCSNN YGPYHFPEKL IPLAIIKALH GEAIPVYGTG ANVRDWLHVE DHADALLLAA       240
     ERGENGESYN IGGRNERTNL EVVQAICRLL DELAPDAAIG SRAKLISFVA DRPGHDARYA       300
     IDASKVEREL GWRARYNFDD GLRQTVQWYL DNRTWWERVR SGVYRGERLG VAV              353
//

If you have problems or comments...

PBIL Back to PBIL home page