(data stored in ACNUC30630 zone)

EMBL: CP001096.PE127

CP001096.PE127       Location/Qualifiers
FT   CDS             complement(140704..141528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0127"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bja:bll4141
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98689"
FT                   /db_xref="GOA:B3Q701"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q701"
FT                   /protein_id="ACE98689.1"
FT                   /translation="MKFVVLTDTHFVARGRRIYGLDPAERLSAAVARINREHPDIAFVI
FT                   VTGDLAHWGEEPAYDNLASVLAGLRAPTILMMGNHDKREAFAKFFPGVPRDASGFVQTV
FT                   QVFEAATIVTLDTLNEAAPNHEGLLCEARLAFLEHALAEAPADRPLLLFQHHPPFDTGL
FT                   RYMDTIRLANPDAEWEVIARTRKPDYLFMGHLHRPISGVWRGIPFHIQRGLAHQVAFDL
FT                   VAEGHIPGSHEPPDYAHVSVEADRIVIHQCSFMYDGPLFSLHDSVALHRVSF"
     MKFVVLTDTH FVARGRRIYG LDPAERLSAA VARINREHPD IAFVIVTGDL AHWGEEPAYD        60
     NLASVLAGLR APTILMMGNH DKREAFAKFF PGVPRDASGF VQTVQVFEAA TIVTLDTLNE       120
     AAPNHEGLLC EARLAFLEHA LAEAPADRPL LLFQHHPPFD TGLRYMDTIR LANPDAEWEV       180
     IARTRKPDYL FMGHLHRPIS GVWRGIPFHI QRGLAHQVAF DLVAEGHIPG SHEPPDYAHV       240
     SVEADRIVIH QCSFMYDGPL FSLHDSVALH RVSF                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page